TDGF1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A1065
Article Name: TDGF1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A1065
Supplier Catalog Number: A1065
Alternative Catalog Number: ABB-A1065-100UL,ABB-A1065-20UL,ABB-A1065-1000UL,ABB-A1065-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CR, CR-1, CRGF, CRIPTO, TDGF1
This gene encodes an epidermal growth factor-related protein that contains a cripto, FRL-1, and cryptic domain. The encoded protein is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. Pseudogenes of this gene are found on chromosomes 2, 3, 6, 8, 19 and X. Alternate splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 6997
UniProt: P13385
Purity: Affinity purification
Sequence: RDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPEL
Target: TDGF1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Growth factors,Stem Cells,Embryonic Stem Cells