ELAVL4 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10655
Artikelname: ELAVL4 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10655
Hersteller Artikelnummer: A10655
Alternativnummer: ABB-A10655-100UL,ABB-A10655-20UL,ABB-A10655-500UL,ABB-A10655-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HUD, PNEM, ELAVL4
Enables mRNA 3-UTR AU-rich region binding activity, poly(A) binding activity, and pre-mRNA intronic pyrimidine-rich binding activity. Involved in 3-UTR-mediated mRNA stabilization, RNA processing, and positive regulation of 3-UTR-mediated mRNA stabilization. Predicted to be located in axon, cytoplasm, and dendrite. Predicted to be part of polysomal ribosome. Predicted to be active in glutamatergic synapse.
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 1996
UniProt: P26378
Reinheit: Affinity purification
Sequenz: MVMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDA
Target-Kategorie: ELAVL4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Neuroscience, Cell Type Marker,Stem Cells,Neural Stem Cells,Neuron marker