ELAVL4 Rabbit pAb, Unconjugated

Catalog Number: ABB-A10655
Article Name: ELAVL4 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10655
Supplier Catalog Number: A10655
Alternative Catalog Number: ABB-A10655-100UL,ABB-A10655-20UL,ABB-A10655-500UL,ABB-A10655-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HUD, PNEM, ELAVL4
Enables mRNA 3-UTR AU-rich region binding activity, poly(A) binding activity, and pre-mRNA intronic pyrimidine-rich binding activity. Involved in 3-UTR-mediated mRNA stabilization, RNA processing, and positive regulation of 3-UTR-mediated mRNA stabilization. Predicted to be located in axon, cytoplasm, and dendrite. Predicted to be part of polysomal ribosome. Predicted to be active in glutamatergic synapse.
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 1996
UniProt: P26378
Purity: Affinity purification
Sequence: MVMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDA
Target: ELAVL4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Neuroscience, Cell Type Marker,Stem Cells,Neural Stem Cells,Neuron marker