CYBA Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10694
Artikelname: CYBA Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10694
Hersteller Artikelnummer: A10694
Alternativnummer: ABB-A10694-20UL,ABB-A10694-100UL,ABB-A10694-1000UL,ABB-A10694-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CGD4, p22-PHOX, CYBA
Cytochrome b is comprised of a light chain (alpha) and a heavy chain (beta). This gene encodes the light, alpha subunit which has been proposed as a primary component of the microbicidal oxidase system of phagocytes. Mutations in this gene are associated with autosomal recessive chronic granulomatous disease (CGD), that is characterized by the failure of activated phagocytes to generate superoxide, which is important for the microbicidal activity of these cells.
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 1535
UniProt: P13498
Reinheit: Affinity purification
Sequenz: VRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV
Target-Kategorie: CYBA
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Cell Biology Developmental Biology,Endocrine Metabolism,Mitochondrial metabolism,Immunology Inflammation