CYBA Rabbit pAb, Unconjugated

Catalog Number: ABB-A10694
Article Name: CYBA Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10694
Supplier Catalog Number: A10694
Alternative Catalog Number: ABB-A10694-20UL,ABB-A10694-100UL,ABB-A10694-1000UL,ABB-A10694-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CGD4, p22-PHOX, CYBA
Cytochrome b is comprised of a light chain (alpha) and a heavy chain (beta). This gene encodes the light, alpha subunit which has been proposed as a primary component of the microbicidal oxidase system of phagocytes. Mutations in this gene are associated with autosomal recessive chronic granulomatous disease (CGD), that is characterized by the failure of activated phagocytes to generate superoxide, which is important for the microbicidal activity of these cells.
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 1535
UniProt: P13498
Purity: Affinity purification
Sequence: VRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV
Target: CYBA
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Cell Biology Developmental Biology,Endocrine Metabolism,Mitochondrial metabolism,Immunology Inflammation