MAGED1/NRAGE Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A1092
- Bilder (2)
| Artikelname: | MAGED1/NRAGE Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A1092 |
| Hersteller Artikelnummer: | A1092 |
| Alternativnummer: | ABB-A1092-20UL,ABB-A1092-100UL,ABB-A1092-500UL,ABB-A1092-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NRAGE, DLXIN-1, MAGED1/NRAGE |
| This gene is a member of the melanoma antigen gene (MAGE) family. Most of the genes of this family encode tumor specific antigens that are not expressed in normal adult tissues except testis. Although the protein encoded by this gene shares strong homology with members of the MAGE family, it is expressed in almost all normal adult tissues. This gene has been demonstrated to be involved in the p75 neurotrophin receptor mediated programmed cell death pathway. Three transcript variants encoding two different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 86kDa |
| NCBI: | 9500 |
| UniProt: | Q9Y5V3 |
| Reinheit: | Affinity purification |
| Sequenz: | EAVLWEALRKMGLRPGVRHPLLGDLRKLLTYEFVKQKYLDYRRVPNSNPPEYEFLWGLRSYHETSKMKVLRFIAEVQKRDPRDWTAQFMEAADEALDALDAAAAEAEARAEARTRMGIGDEAVSGPWSWDDIEFELLTWDEEGDFGDPWSRIPFTFWARYHQNARSRFPQTFAGPIIGPGGTASANFAANFGAIGFFWVE |
| Target-Kategorie: | MAGED1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:100 - 1:500|IHC-P,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,p53 pathway,Cell Biology Developmental Biology,Apoptosis |


