MAGED1/NRAGE Rabbit pAb, Unconjugated

Catalog Number: ABB-A1092
Article Name: MAGED1/NRAGE Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A1092
Supplier Catalog Number: A1092
Alternative Catalog Number: ABB-A1092-20UL,ABB-A1092-100UL,ABB-A1092-500UL,ABB-A1092-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: NRAGE, DLXIN-1, MAGED1/NRAGE
This gene is a member of the melanoma antigen gene (MAGE) family. Most of the genes of this family encode tumor specific antigens that are not expressed in normal adult tissues except testis. Although the protein encoded by this gene shares strong homology with members of the MAGE family, it is expressed in almost all normal adult tissues. This gene has been demonstrated to be involved in the p75 neurotrophin receptor mediated programmed cell death pathway. Three transcript variants encoding two different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 86kDa
NCBI: 9500
UniProt: Q9Y5V3
Purity: Affinity purification
Sequence: EAVLWEALRKMGLRPGVRHPLLGDLRKLLTYEFVKQKYLDYRRVPNSNPPEYEFLWGLRSYHETSKMKVLRFIAEVQKRDPRDWTAQFMEAADEALDALDAAAAEAEARAEARTRMGIGDEAVSGPWSWDDIEFELLTWDEEGDFGDPWSRIPFTFWARYHQNARSRFPQTFAGPIIGPGGTASANFAANFGAIGFFWVE
Target: MAGED1
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|IHC-P,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,p53 pathway,Cell Biology Developmental Biology,Apoptosis