POLR2A Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11181
Artikelname: POLR2A Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11181
Hersteller Artikelnummer: A11181
Alternativnummer: ABB-A11181-100UL,ABB-A11181-20UL,ABB-A11181-500UL,ABB-A11181-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: RPB1, RPO2, POLR2, POLRA, RPBh1, RPOL2, NEDHIB, RpIILS, hsRPB1, hRPB220, POLR2A
This gene encodes the largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains a carboxy terminal domain composed of heptapeptide repeats that are essential for polymerase activity. These repeats contain serine and threonine residues that are phosphorylated in actively transcribing RNA polymerase. In addition, this subunit, in combination with several other polymerase subunits, forms the DNA binding domain of the polymerase, a groove in which the DNA template is transcribed into RNA.
Klonalität: Polyclonal
Molekulargewicht: 217kDa
NCBI: 5430
UniProt: P24928
Reinheit: Affinity purification
Sequenz: MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPV
Target-Kategorie: POLR2A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.|ChIP,5µg antibody for 10µg-15µg of Chromatin
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Protein phosphorylation,Neuroscience,Neurodegenerative Diseases