POLR2A Rabbit pAb, Unconjugated

Catalog Number: ABB-A11181
Article Name: POLR2A Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11181
Supplier Catalog Number: A11181
Alternative Catalog Number: ABB-A11181-100UL,ABB-A11181-20UL,ABB-A11181-500UL,ABB-A11181-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ChIP, ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RPB1, RPO2, POLR2, POLRA, RPBh1, RPOL2, NEDHIB, RpIILS, hsRPB1, hRPB220, POLR2A
This gene encodes the largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains a carboxy terminal domain composed of heptapeptide repeats that are essential for polymerase activity. These repeats contain serine and threonine residues that are phosphorylated in actively transcribing RNA polymerase. In addition, this subunit, in combination with several other polymerase subunits, forms the DNA binding domain of the polymerase, a groove in which the DNA template is transcribed into RNA.
Clonality: Polyclonal
Molecular Weight: 217kDa
NCBI: 5430
UniProt: P24928
Purity: Affinity purification
Sequence: MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPV
Target: POLR2A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.|ChIP,5µg antibody for 10µg-15µg of Chromatin
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Protein phosphorylation,Neuroscience,Neurodegenerative Diseases