Galectin 3/LGALS3 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11198
Artikelname: Galectin 3/LGALS3 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11198
Hersteller Artikelnummer: A11198
Alternativnummer: ABB-A11198-20UL,ABB-A11198-100UL,ABB-A11198-1000UL,ABB-A11198-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: L31, GAL3, MAC2, CBP35, GALBP, GALIG, LGALS2, Galectin 3/LGALS3
This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix,the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis,innate immunity,cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0542]
Molekulargewicht: 26kDa
NCBI: 3958
UniProt: P17931
Reinheit: Affinity purification
Sequenz: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGA
Target-Kategorie: LGALS3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IHC-P,1:200 - 1:800|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Cell Adhesion,Neuroscience