Galectin 3/LGALS3 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11198
Article Name: Galectin 3/LGALS3 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11198
Supplier Catalog Number: A11198
Alternative Catalog Number: ABB-A11198-20UL,ABB-A11198-100UL,ABB-A11198-1000UL,ABB-A11198-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: L31, GAL3, MAC2, CBP35, GALBP, GALIG, LGALS2, Galectin 3/LGALS3
This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix,the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis,innate immunity,cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.
Clonality: Monoclonal
Clone Designation: [ARC0542]
Molecular Weight: 26kDa
NCBI: 3958
UniProt: P17931
Purity: Affinity purification
Sequence: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGA
Target: LGALS3
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|IHC-P,1:200 - 1:800|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Cell Adhesion,Neuroscience