Aquaporin-4 (AQP4) Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11210
Artikelname: Aquaporin-4 (AQP4) Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11210
Hersteller Artikelnummer: A11210
Alternativnummer: ABB-A11210-20UL,ABB-A11210-100UL,ABB-A11210-1000UL,ABB-A11210-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MIWC, WCH4, hAQP4, Aquaporin-4 (AQP4)
This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. This protein is the predominant aquaporin found in brain and has an important role in brain water homeostasis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. Additional isoforms, resulting from the use of alternative in-frame translation initiation codons, have also been described. Recent studies provided evidence for translational readthrough in this gene, and expression of C-terminally extended isoforms via the use of an alternative in-frame translation termination codon.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC54345]
Molekulargewicht: 32KDa/34kDa
NCBI: 361
UniProt: P55087
Reinheit: Affinity purification
Sequenz: VEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Target-Kategorie: AQP4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:5000 - 1:20000|IF-P,1:200 - 1:800|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases Markers,Other Neurological disorders