Aquaporin-4 (AQP4) Rabbit mAb, Unconjugated

Catalog Number: ABB-A11210
Article Name: Aquaporin-4 (AQP4) Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11210
Supplier Catalog Number: A11210
Alternative Catalog Number: ABB-A11210-20UL,ABB-A11210-100UL,ABB-A11210-1000UL,ABB-A11210-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MIWC, WCH4, hAQP4, Aquaporin-4 (AQP4)
This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. This protein is the predominant aquaporin found in brain and has an important role in brain water homeostasis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. Additional isoforms, resulting from the use of alternative in-frame translation initiation codons, have also been described. Recent studies provided evidence for translational readthrough in this gene, and expression of C-terminally extended isoforms via the use of an alternative in-frame translation termination codon.
Clonality: Monoclonal
Clone Designation: [ARC54345]
Molecular Weight: 32KDa/34kDa
NCBI: 361
UniProt: P55087
Purity: Affinity purification
Sequence: VEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Target: AQP4
Antibody Type: Primary Antibody
Application Dilute: WB,1:5000 - 1:20000|IF-P,1:200 - 1:800|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases Markers,Other Neurological disorders