FABP1 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11213
Artikelname: FABP1 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11213
Hersteller Artikelnummer: A11213
Alternativnummer: ABB-A11213-20UL,ABB-A11213-100UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FABPL, L-FABP, FABP1
This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0545]
Molekulargewicht: 14kDa
NCBI: 2168
UniProt: P07148
Reinheit: Affinity purification
Sequenz: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKS
Target-Kategorie: FABP1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IF/ICC,1:100 - 1:400|IF-P,1:100 - 1:400|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism