FABP1 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11213
Article Name: FABP1 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11213
Supplier Catalog Number: A11213
Alternative Catalog Number: ABB-A11213-20UL,ABB-A11213-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FABPL, L-FABP, FABP1
This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.
Clonality: Monoclonal
Clone Designation: [ARC0545]
Molecular Weight: 14kDa
NCBI: 2168
UniProt: P07148
Purity: Affinity purification
Sequence: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKS
Target: FABP1
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|IF/ICC,1:100 - 1:400|IF-P,1:100 - 1:400|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism