ATP5A1 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11217
Artikelname: ATP5A1 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11217
Hersteller Artikelnummer: A11217
Alternativnummer: ABB-A11217-100UL,ABB-A11217-20UL,ABB-A11217-1000UL,ABB-A11217-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: OMR, ORM, ATPM, MOM2, ATP5A, hATP1, ATP5A1, MC5DN4, ATP5AL2, COXPD22, HEL-S-123m
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, using an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the alpha subunit of the catalytic core. Alternatively spliced transcript variants encoding the different isoforms have been identified. Pseudogenes of this gene are located on chromosomes 9, 2, and 16.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0549]
Molekulargewicht: 60kDa
NCBI: 498
UniProt: P25705
Reinheit: Affinity purification
Sequenz: VPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
Target-Kategorie: ATP5F1A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:10000 - 1:40000|IP,0.5µg-4µg antibody for 400µg-600µg extracts of whole cells|IF/ICC,1:200 - 1:2000|IF-P,1:200 - 1:2000|IHC-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Oxidative phosphorylation,Neuroscience,Neurodegenerative Diseases