ATP5A1 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11217
Article Name: ATP5A1 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11217
Supplier Catalog Number: A11217
Alternative Catalog Number: ABB-A11217-100UL,ABB-A11217-20UL,ABB-A11217-1000UL,ABB-A11217-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: OMR, ORM, ATPM, MOM2, ATP5A, hATP1, ATP5A1, MC5DN4, ATP5AL2, COXPD22, HEL-S-123m
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, using an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the alpha subunit of the catalytic core. Alternatively spliced transcript variants encoding the different isoforms have been identified. Pseudogenes of this gene are located on chromosomes 9, 2, and 16.
Clonality: Monoclonal
Clone Designation: [ARC0549]
Molecular Weight: 60kDa
NCBI: 498
UniProt: P25705
Purity: Affinity purification
Sequence: VPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
Target: ATP5F1A
Antibody Type: Primary Antibody
Application Dilute: WB,1:10000 - 1:40000|IP,0.5µg-4µg antibody for 400µg-600µg extracts of whole cells|IF/ICC,1:200 - 1:2000|IF-P,1:200 - 1:2000|IHC-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Oxidative phosphorylation,Neuroscience,Neurodegenerative Diseases