Annexin A2 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11235
Artikelname: Annexin A2 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11235
Hersteller Artikelnummer: A11235
Alternativnummer: ABB-A11235-100UL,ABB-A11235-20UL,ABB-A11235-500UL,ABB-A11235-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: P36, ANX2, LIP2, LPC2, CAL1H, LPC2D, ANX2L4, PAP-IV, HEL-S-270, Annexin A2
This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. Annexin A2 expression has been found to correlate with resistance to treatment against various cancer forms.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0554]
Molekulargewicht: 39kDa
NCBI: 302
UniProt: P07355
Reinheit: Affinity purification
Sequenz: MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVIL
Target-Kategorie: ANXA2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IHC-P,1:800 - 1:10000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Neuroscience,Calcium Signaling