Annexin A2 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11235
Article Name: Annexin A2 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11235
Supplier Catalog Number: A11235
Alternative Catalog Number: ABB-A11235-100UL,ABB-A11235-20UL,ABB-A11235-500UL,ABB-A11235-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: P36, ANX2, LIP2, LPC2, CAL1H, LPC2D, ANX2L4, PAP-IV, HEL-S-270, Annexin A2
This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. Annexin A2 expression has been found to correlate with resistance to treatment against various cancer forms.
Clonality: Monoclonal
Clone Designation: [ARC0554]
Molecular Weight: 39kDa
NCBI: 302
UniProt: P07355
Purity: Affinity purification
Sequence: MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVIL
Target: ANXA2
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|IHC-P,1:800 - 1:10000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Neuroscience,Calcium Signaling