SERPINC1 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11249
Artikelname: SERPINC1 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11249
Hersteller Artikelnummer: A11249
Alternativnummer: ABB-A11249-20UL,ABB-A11249-100UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AT3, AT3D, ATIII, THPH7, ATIII-R2, ATIII-T1, ATIII-T2, SERPINC1
The protein encoded by this gene, antithrombin III, is a plasma protease inhibitor and a member of the serpin superfamily. This protein inhibits thrombin as well as other activated serine proteases of the coagulation system, and it regulates the blood coagulation cascade. The protein includes two functional domains: the heparin binding-domain at the N-terminus of the mature protein, and the reactive site domain at the C-terminus. The inhibitory activity is enhanced by the presence of heparin. Numerous mutations have been identified for this gene, many of which are known to cause antithrombin-III deficiency which constitutes a strong risk factor for thrombosis. A reduction in the serum level of this protein is associated with severe cases of Coronavirus Disease 19 (COVID-19).
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0559]
Molekulargewicht: 58kDa
NCBI: 462
UniProt: P01008
Reinheit: Affinity purification
Sequenz: MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQKIPEATNRRVWELSKANSRFATTFYQHLAD
Target-Kategorie: SERPINC1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Stem Cells,Cardiovascular,Blood,Serum Proteins