SERPINC1 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11249
Article Name: SERPINC1 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11249
Supplier Catalog Number: A11249
Alternative Catalog Number: ABB-A11249-20UL,ABB-A11249-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AT3, AT3D, ATIII, THPH7, ATIII-R2, ATIII-T1, ATIII-T2, SERPINC1
The protein encoded by this gene, antithrombin III, is a plasma protease inhibitor and a member of the serpin superfamily. This protein inhibits thrombin as well as other activated serine proteases of the coagulation system, and it regulates the blood coagulation cascade. The protein includes two functional domains: the heparin binding-domain at the N-terminus of the mature protein, and the reactive site domain at the C-terminus. The inhibitory activity is enhanced by the presence of heparin. Numerous mutations have been identified for this gene, many of which are known to cause antithrombin-III deficiency which constitutes a strong risk factor for thrombosis. A reduction in the serum level of this protein is associated with severe cases of Coronavirus Disease 19 (COVID-19).
Clonality: Monoclonal
Clone Designation: [ARC0559]
Molecular Weight: 58kDa
NCBI: 462
UniProt: P01008
Purity: Affinity purification
Sequence: MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQKIPEATNRRVWELSKANSRFATTFYQHLAD
Target: SERPINC1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Stem Cells,Cardiovascular,Blood,Serum Proteins