Cardiac troponin T (TNNT2) Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Cardiac troponin T (TNNT2) Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1126
• Hersteller Artikelnummer: A1126
• Alternativnummer: ABB-A1126-100UL,ABB-A1126-20UL,ABB-A1126-500UL,ABB-A1126-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CMH2, RCM3, TnTC, cTnT, CMD1D, CMPD2, LVNC6, Cardiac troponin T (TNNT2)

Produktbeschreibung

This gene encodes the cardiac isoform of troponin T. The encoded protein is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 31-36 kDa
• NCBI: 7139
• UniProt: P45379
• Reinheit: Affinity purification
• Sequenz: MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEEL
• Target-Kategorie: TNNT2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|IF-P,1:50 - 1:200|IHC-P,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Stem Cells,Mesenchymal Stem Cells,Cardiovascular,Heart,Contractility

Bilder