Cardiac troponin T (TNNT2) Rabbit pAb, Unconjugated

Catalog Number: ABB-A1126
Article Name: Cardiac troponin T (TNNT2) Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A1126
Supplier Catalog Number: A1126
Alternative Catalog Number: ABB-A1126-100UL,ABB-A1126-20UL,ABB-A1126-500UL,ABB-A1126-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CMH2, RCM3, TnTC, cTnT, CMD1D, CMPD2, LVNC6, Cardiac troponin T (TNNT2)
This gene encodes the cardiac isoform of troponin T. The encoded protein is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy.
Clonality: Polyclonal
Molecular Weight: 31-36 kDa
NCBI: 7139
UniProt: P45379
Purity: Affinity purification
Sequence: MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEEL
Target: TNNT2
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|IF-P,1:50 - 1:200|IHC-P,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Stem Cells,Mesenchymal Stem Cells,Cardiovascular,Heart,Contractility