PHPT1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: PHPT1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1127
• Hersteller Artikelnummer: A1127
• Alternativnummer: ABB-A1127-20UL,ABB-A1127-100UL,ABB-A1127-1000UL,ABB-A1127-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PHP, PHP14, CGI-202, HSPC141, HEL-S-132P, PHPT1

Produktbeschreibung

This gene encodes an enzyme that catalyzes the reversible dephosphorylation of histidine residues in proteins. It may be involved in the dephosphorylation of G-beta and ATP citrate lyase and in negatively regulating CD4 T lymphocytes by dephosphorylation and inhibition of KCa3.1 channels. Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 14kDa
• NCBI: 29085
• UniProt: Q9NRX4
• Reinheit: Affinity purification
• Sequenz: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
• Target-Kategorie: PHPT1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat

Bilder