PHPT1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: PHPT1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A1127
• Supplier Catalog Number: A1127
• Alternative Catalog Number: ABB-A1127-20UL,ABB-A1127-100UL,ABB-A1127-1000UL,ABB-A1127-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PHP, PHP14, CGI-202, HSPC141, HEL-S-132P, PHPT1

Product Description

This gene encodes an enzyme that catalyzes the reversible dephosphorylation of histidine residues in proteins. It may be involved in the dephosphorylation of G-beta and ATP citrate lyase and in negatively regulating CD4 T lymphocytes by dephosphorylation and inhibition of KCa3.1 channels. Alternative splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 14kDa
• NCBI: 29085
• UniProt: Q9NRX4
• Purity: Affinity purification
• Sequence: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
• Target: PHPT1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat

Images