[KO Validated] NADPH oxidase 4 (NOX4) Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11274
Artikelname: [KO Validated] NADPH oxidase 4 (NOX4) Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11274
Hersteller Artikelnummer: A11274
Alternativnummer: ABB-A11274-100UL,ABB-A11274-20UL,ABB-A11274-1000UL,ABB-A11274-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: KOX, KOX-1, RENOX, 4)
This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 67kDa
NCBI: 50507
UniProt: Q9NPH5
Reinheit: Affinity purification
Sequenz: KENFKARPGQYITLHCPSVSALENHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS
Target-Kategorie: NOX4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Drug metabolism,Immunology Inflammation,Cardiovascular,Blood,Heart,Cardiovascular diseases,Heart disease