[KO Validated] NADPH oxidase 4 (NOX4) Rabbit pAb, Unconjugated

Catalog Number: ABB-A11274
Article Name: [KO Validated] NADPH oxidase 4 (NOX4) Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11274
Supplier Catalog Number: A11274
Alternative Catalog Number: ABB-A11274-100UL,ABB-A11274-20UL,ABB-A11274-1000UL,ABB-A11274-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: KOX, KOX-1, RENOX, 4)
This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 67kDa
NCBI: 50507
UniProt: Q9NPH5
Purity: Affinity purification
Sequence: KENFKARPGQYITLHCPSVSALENHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS
Target: NOX4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Drug metabolism,Immunology Inflammation,Cardiovascular,Blood,Heart,Cardiovascular diseases,Heart disease