GC1q R/C1QBP Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11292
Artikelname: GC1q R/C1QBP Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11292
Hersteller Artikelnummer: A11292
Alternativnummer: ABB-A11292-100UL,ABB-A11292-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: p32, HABP1, gC1qR, GC1QBP, SF2p32, gC1Q-R, COXPD33, SF2AP32, GC1q R/C1QBP
The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2753]
Molekulargewicht: 31kDa
NCBI: 708
UniProt: Q07021
Reinheit: Affinity purification
Sequenz: KTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAE
Target-Kategorie: C1QBP
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway