GC1q R/C1QBP Rabbit mAb, Unconjugated

Catalog Number: ABB-A11292
Article Name: GC1q R/C1QBP Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11292
Supplier Catalog Number: A11292
Alternative Catalog Number: ABB-A11292-100UL,ABB-A11292-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: p32, HABP1, gC1qR, GC1QBP, SF2p32, gC1Q-R, COXPD33, SF2AP32, GC1q R/C1QBP
The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein.
Clonality: Monoclonal
Clone Designation: [ARC2753]
Molecular Weight: 31kDa
NCBI: 708
UniProt: Q07021
Purity: Affinity purification
Sequence: KTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAE
Target: C1QBP
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway