Ephrin B2 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: Ephrin B2 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A11349
• Hersteller Artikelnummer: A11349
• Alternativnummer: ABB-A11349-100UL,ABB-A11349-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HTKL, EPLG5, Htk-L, LERK5, ephrin-B2, Ephrin B2

Produktbeschreibung

This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNB class ephrin which binds to the EPHB4 and EPHA3 receptors.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0576]
• Molekulargewicht: 37kDa
• NCBI: 1948
• UniProt: P52799
• Reinheit: Affinity purification
• Sequenz: MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLN
• Target-Kategorie: EFNB2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:6000|IHC-P,1:100 - 1:400|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Kinase,Cell Biology Developmental Biology,Growth factors,Neuroscience, Cell Type Marker,Cardiovascular,Angiogenesis,Neuron marker

Bilder