Ephrin B2 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11349
Article Name: Ephrin B2 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11349
Supplier Catalog Number: A11349
Alternative Catalog Number: ABB-A11349-100UL,ABB-A11349-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HTKL, EPLG5, Htk-L, LERK5, ephrin-B2, Ephrin B2
This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNB class ephrin which binds to the EPHB4 and EPHA3 receptors.
Clonality: Monoclonal
Clone Designation: [ARC0576]
Molecular Weight: 37kDa
NCBI: 1948
UniProt: P52799
Purity: Affinity purification
Sequence: MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLN
Target: EFNB2
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|IHC-P,1:100 - 1:400|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Kinase,Cell Biology Developmental Biology,Growth factors,Neuroscience, Cell Type Marker,Cardiovascular,Angiogenesis,Neuron marker