Histone H2AX Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11361
Artikelname: Histone H2AX Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11361
Hersteller Artikelnummer: A11361
Alternativnummer: ABB-A11361-1000UL,ABB-A11361-500UL,ABB-A11361-20UL,ABB-A11361-100UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: H2A.X, H2A/X, H2AFX, Histone H2AX
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-independent histone that is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.
Molekulargewicht: 15kDa
NCBI: 3014
UniProt: P16104
Reinheit: Affinity purification
Sequenz: VYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Target-Kategorie: H2AX
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat,Other (Wide Range Predicted). ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Protein phosphorylation,ATM Signaling Pathway