Histone H2AX Rabbit pAb, Unconjugated

Catalog Number: ABB-A11361
Article Name: Histone H2AX Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11361
Supplier Catalog Number: A11361
Alternative Catalog Number: ABB-A11361-1000UL,ABB-A11361-500UL,ABB-A11361-20UL,ABB-A11361-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: H2A.X, H2A/X, H2AFX, Histone H2AX
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-independent histone that is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.
Molecular Weight: 15kDa
NCBI: 3014
UniProt: P16104
Purity: Affinity purification
Sequence: VYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Target: H2AX
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat,Other (Wide Range Predicted). ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Protein phosphorylation,ATM Signaling Pathway