GOT1 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11363
Artikelname: GOT1 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11363
Hersteller Artikelnummer: A11363
Alternativnummer: ABB-A11363-100UL,ABB-A11363-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AST, AST1, SGOT, cCAT, GIG18, cAspAT, ASTQTL1, GOT1
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0579]
Molekulargewicht: 46kDa
NCBI: 2805
UniProt: P17174
Reinheit: Affinity purification
Sequenz: AAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFE
Target-Kategorie: GOT1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism,Carbohydrate metabolism