GOT1 Rabbit mAb, Unconjugated

Product Overview

• Article Name: GOT1 Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A11363
• Supplier Catalog Number: A11363
• Alternative Catalog Number: ABB-A11363-100UL,ABB-A11363-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: AST, AST1, SGOT, cCAT, GIG18, cAspAT, ASTQTL1, GOT1

Product Description

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC0579]
• Molecular Weight: 46kDa
• NCBI: 2805
• UniProt: P17174
• Purity: Affinity purification
• Sequence: AAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFE
• Target: GOT1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:6000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism,Carbohydrate metabolism

Images