c-Jun Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11378
Artikelname: c-Jun Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11378
Hersteller Artikelnummer: A11378
Alternativnummer: ABB-A11378-100UL,ABB-A11378-20UL,ABB-A11378-500UL,ABB-A11378-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AP1, p39, AP-1, cJUN, c-Jun
This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 3725
UniProt: P05412
Reinheit: Affinity purification
Sequenz: MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK
Target-Kategorie: JUN
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Cancer,Signal Transduction,ErbB-HER Signaling Pathway,MAPK-JNK Signaling Pathway,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling