c-Jun Rabbit pAb, Unconjugated

Catalog Number: ABB-A11378
Article Name: c-Jun Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11378
Supplier Catalog Number: A11378
Alternative Catalog Number: ABB-A11378-100UL,ABB-A11378-20UL,ABB-A11378-500UL,ABB-A11378-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AP1, p39, AP-1, cJUN, c-Jun
This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 3725
UniProt: P05412
Purity: Affinity purification
Sequence: MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK
Target: JUN
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Cancer,Signal Transduction,ErbB-HER Signaling Pathway,MAPK-JNK Signaling Pathway,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling