delta-Catenin/p120 Catenin Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: delta-Catenin/p120 Catenin Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A11399
• Hersteller Artikelnummer: A11399
• Alternativnummer: ABB-A11399-100UL,ABB-A11399-20UL,ABB-A11399-500UL,ABB-A11399-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CAS, p120, BCDS2, CTNND, P120CAS, P120CTN, p120(CAS), p120(CTN), delta-Catenin/p120 Catenin

Produktbeschreibung

This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0586]
• Molekulargewicht: 108kDa
• NCBI: 1500
• UniProt: O60716
• Reinheit: Affinity purification
• Sequenz: TLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI
• Target-Kategorie: CTNND1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,0.5µg-4µg antibody for 400µg-600µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Signal Transduction,G protein signaling,Cell Biology Developmental Biology,Cell Adhesion,Tight Junctions,Cytoskeleton,Microfilaments,Wnt -Catenin Signaling Pathway,Stem Cells

Bilder