delta-Catenin/p120 Catenin Rabbit mAb, Unconjugated

Product Overview

• Article Name: delta-Catenin/p120 Catenin Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A11399
• Supplier Catalog Number: A11399
• Alternative Catalog Number: ABB-A11399-100UL,ABB-A11399-20UL,ABB-A11399-500UL,ABB-A11399-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, IP, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CAS, p120, BCDS2, CTNND, P120CAS, P120CTN, p120(CAS), p120(CTN), delta-Catenin/p120 Catenin

Product Description

This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC0586]
• Molecular Weight: 108kDa
• NCBI: 1500
• UniProt: O60716
• Purity: Affinity purification
• Sequence: TLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI
• Target: CTNND1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,0.5µg-4µg antibody for 400µg-600µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Signal Transduction,G protein signaling,Cell Biology Developmental Biology,Cell Adhesion,Tight Junctions,Cytoskeleton,Microfilaments,Wnt -Catenin Signaling Pathway,Stem Cells

Images