BMP4 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11405
Artikelname: BMP4 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11405
Hersteller Artikelnummer: A11405
Alternativnummer: ABB-A11405-100UL,ABB-A11405-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ZYME, BMP2B, OFC11, BMP2B1, MCOPS6, BMP4
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates heart development and adipogenesis. Mutations in this gene are associated with orofacial cleft and microphthalmia in human patients. The encoded protein may also be involved in the pathology of multiple cardiovascular diseases and human cancers.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0587]
Molekulargewicht: 47kDa
NCBI: 652
UniProt: P12644
Reinheit: Affinity purification
Sequenz: RRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Target-Kategorie: BMP4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,TGF-b-Smad Signaling Pathway,Wnt -Catenin Signaling Pathway,ESC Pluripotency and Differentiation,Immunology Inflammation,Cytokines,NF-kB Signaling Pathway,Stem Cells,Cardiovascular,Angiogenesis