BMP4 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11405
Article Name: BMP4 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11405
Supplier Catalog Number: A11405
Alternative Catalog Number: ABB-A11405-100UL,ABB-A11405-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ZYME, BMP2B, OFC11, BMP2B1, MCOPS6, BMP4
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates heart development and adipogenesis. Mutations in this gene are associated with orofacial cleft and microphthalmia in human patients. The encoded protein may also be involved in the pathology of multiple cardiovascular diseases and human cancers.
Clonality: Monoclonal
Clone Designation: [ARC0587]
Molecular Weight: 47kDa
NCBI: 652
UniProt: P12644
Purity: Affinity purification
Sequence: RRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Target: BMP4
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,TGF-b-Smad Signaling Pathway,Wnt -Catenin Signaling Pathway,ESC Pluripotency and Differentiation,Immunology Inflammation,Cytokines,NF-kB Signaling Pathway,Stem Cells,Cardiovascular,Angiogenesis