MAD2/MAD2L1 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: MAD2/MAD2L1 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A11469
• Hersteller Artikelnummer: A11469
• Alternativnummer: ABB-A11469-20UL,ABB-A11469-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MAD2, HSMAD2, MAD2/MAD2L1

Produktbeschreibung

MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0603]
• Molekulargewicht: 24kDa
• NCBI: 4085
• UniProt: Q13257
• Reinheit: Affinity purification
• Sequenz: EQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCS
• Target-Kategorie: MAD2L1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cancer,Cell Biology Developmental Biology,Cell Cycle

Bilder