MAD2/MAD2L1 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11469
Article Name: MAD2/MAD2L1 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11469
Supplier Catalog Number: A11469
Alternative Catalog Number: ABB-A11469-20UL,ABB-A11469-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MAD2, HSMAD2, MAD2/MAD2L1
MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14.
Clonality: Monoclonal
Clone Designation: [ARC0603]
Molecular Weight: 24kDa
NCBI: 4085
UniProt: Q13257
Purity: Affinity purification
Sequence: EQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCS
Target: MAD2L1
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cancer,Cell Biology Developmental Biology,Cell Cycle