CES1 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11478
Artikelname: CES1 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11478
Hersteller Artikelnummer: A11478
Alternativnummer: ABB-A11478-100UL,ABB-A11478-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CEH, REH, TGH, ACAT, CE-1, CES2, HMSE, SES1, HMSE1, PCE-1, hCE-1, CES1
This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This enzyme is the major liver enzyme and functions in liver drug clearance. Mutations of this gene cause carboxylesterase 1 deficiency. Three transcript variants encoding three different isoforms have been found for this gene.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0613]
Molekulargewicht: 63kDa
NCBI: 1066
UniProt: P23141
Reinheit: Affinity purification
Sequenz: MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSEL
Target-Kategorie: CES1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IF-P,1:100 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cholesterol Metabolism,Drug metabolism,Immunology Inflammation,CDs,Cardiovascular,Lipids