CES1 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11478
Article Name: CES1 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11478
Supplier Catalog Number: A11478
Alternative Catalog Number: ABB-A11478-100UL,ABB-A11478-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CEH, REH, TGH, ACAT, CE-1, CES2, HMSE, SES1, HMSE1, PCE-1, hCE-1, CES1
This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This enzyme is the major liver enzyme and functions in liver drug clearance. Mutations of this gene cause carboxylesterase 1 deficiency. Three transcript variants encoding three different isoforms have been found for this gene.
Clonality: Monoclonal
Clone Designation: [ARC0613]
Molecular Weight: 63kDa
NCBI: 1066
UniProt: P23141
Purity: Affinity purification
Sequence: MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSEL
Target: CES1
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|IF-P,1:100 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cholesterol Metabolism,Drug metabolism,Immunology Inflammation,CDs,Cardiovascular,Lipids