ARF6 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11485
Artikelname: ARF6 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11485
Hersteller Artikelnummer: A11485
Alternativnummer: ABB-A11485-100UL,ABB-A11485-20UL,ABB-A11485-500UL,ABB-A11485-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ARF6, ADP-ribosylation factor 6
This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0617]
Molekulargewicht: 20kDa
NCBI: 382
UniProt: P62330
Reinheit: Affinity purification
Sequenz: HYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
Target-Kategorie: ARF6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal transduction,G protein signaling,ErbB-HER signaling pathway.