ARF6 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11485
Article Name: ARF6 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11485
Supplier Catalog Number: A11485
Alternative Catalog Number: ABB-A11485-100UL,ABB-A11485-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ARF6, ADP-ribosylation factor 6
This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7.
Clonality: Monoclonal
Clone Designation: [ARC0617]
Molecular Weight: 20kDa
NCBI: 382
UniProt: P62330
Purity: Affinity purification
Sequence: HYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
Target: ARF6
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal transduction,G protein signaling,ErbB-HER signaling pathway