Lamin B1 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11495
Artikelname: Lamin B1 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11495
Hersteller Artikelnummer: A11495
Alternativnummer: ABB-A11495-100UL,ABB-A11495-20UL,ABB-A11495-1000UL,ABB-A11495-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: LMN, ADLD, LMN2, LMNB, MCPH26
This gene encodes one of the two B-type lamin proteins and is a component of the nuclear lamina. A duplication of this gene is associated with autosomal dominant adult-onset leukodystrophy (ADLD). Alternative splicing results in multiple transcript variants.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0621]
Molekulargewicht: 66kDa
NCBI: 4001
UniProt: P20700
Reinheit: Affinity purification
Sequenz: DGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTI
Target-Kategorie: LMNB1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IHC-P,1:200 - 1:2000
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cytoskeleton,Intermediate Filaments