Lamin B1 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11495
Article Name: Lamin B1 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11495
Supplier Catalog Number: A11495
Alternative Catalog Number: ABB-A11495-100UL,ABB-A11495-20UL,ABB-A11495-1000UL,ABB-A11495-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LMN, ADLD, LMN2, LMNB, MCPH26
This gene encodes one of the two B-type lamin proteins and is a component of the nuclear lamina. A duplication of this gene is associated with autosomal dominant adult-onset leukodystrophy (ADLD). Alternative splicing results in multiple transcript variants.
Clonality: Monoclonal
Clone Designation: [ARC0621]
Molecular Weight: 66kDa
NCBI: 4001
UniProt: P20700
Purity: Affinity purification
Sequence: DGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTI
Target: LMNB1
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|IHC-P,1:200 - 1:2000
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cytoskeleton,Intermediate Filaments