CELF1 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: CELF1 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A1150
• Hersteller Artikelnummer: A1150
• Alternativnummer: ABB-A1150-100UL,ABB-A1150-20UL,ABB-A1150-1000UL,ABB-A1150-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CUGBP, NAB50, NAPOR, CUG-BP, CUGBP1, hNab50, BRUNOL2, EDEN-BP, CELF1

Produktbeschreibung

Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC1866]
• Molekulargewicht: 52kDa
• NCBI: 10658
• UniProt: Q92879
• Reinheit: Affinity purification
• Sequenz: MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSE
• Target-Kategorie: CELF1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Neuroscience,Neurodegenerative Diseases.

Bilder